Gene Bio Systems
Recombinant Mouse BET1-like protein(Bet1l)
Recombinant Mouse BET1-like protein(Bet1l)
SKU:CSB-CF002671MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O35153
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADWTRAQSSGAVEDILDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTMARSGRDNRKLLCGMAVVLIVAFFILSYLLSRTRT
Protein Names:Recommended name: BET1-like protein Alternative name(s): Golgi SNARE with a size of 15 kDa Short name= GOS-15 Short name= GS15 Vesicle transport protein GOS15
Gene Names:Name:Bet1l Synonyms:Gs15
Expression Region:1-111
Sequence Info:full length protein
