Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse B-cell antigen receptor complex-associated protein alpha chain(Cd79a)

Recombinant Mouse B-cell antigen receptor complex-associated protein alpha chain(Cd79a)

SKU:CSB-CF004957MO

Regular price £1,283.00 GBP
Regular price Sale price £1,283.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P11911

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP

Protein Names:Recommended name: B-cell antigen receptor complex-associated protein alpha chain Alternative name(s): Ig-alpha MB-1 membrane glycoprotein Membrane-bound immunoglobulin-associated protein Surface IgM-associated protein CD_antigen= CD79a

Gene Names:Name:Cd79a Synonyms:Iga, Mb-1

Expression Region:29-220

Sequence Info:full length protein

View full details