Gene Bio Systems
Recombinant Mouse Anterior gradient protein 2 homolog(Agr2)
Recombinant Mouse Anterior gradient protein 2 homolog(Agr2)
SKU:CSB-YP001458MO
Couldn't load pickup availability
Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cancer
Uniprot ID:O88312
Gene Names:Agr2
Organism:Mus musculus (Mouse)
AA Sequence:KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
Expression Region:21-175aa
Sequence Info:Full Length of Mature Protein
Source:Yeast
Tag Info:N-terminal 6xHis-tagged
MW:19.9 kDa
Alternative Name(s):Protein Gob-4 Secreted cement gland protein XAG-2 homolog
Relevance:Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth (By similarity). Promotes cell adhesion (By similarity).
Reference:"The protein disulfide isomerase AGR2 is essential for production of intestinal mucus." Park S.-W., Zhen G., Verhaeghe C., Nakagami Y., Nguyenvu L.T., Barczak A.J., Killeen N., Erle D.J. Proc. Natl. Acad. Sci. U.S.A. 106:6950-6955(2009)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
