Recombinant Mouse Angiogenin-4(Ang4)

Recombinant Mouse Angiogenin-4(Ang4)

CSB-EP661010MOa3
Regular price
£540.00 GBP
Sale price
£540.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Cardiovascular

Uniprot ID: Q3TMQ6

Gene Names: Ang4

Organism: Mus musculus (Mouse)

AA Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Expression Region: 25-144aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 31.4 kDa

Alternative Name(s):

Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).

Reference: "Identification of a purine-rich intronic enhancer element in the mouse eosinophil-associated ribonuclease 2 (mEar 2) gene." Dyer K.D., Nitto T., Moreau J.M., McDevitt A.L., Rosenberg H.F. Mamm. Genome 15:126-134(2004)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share