Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse ADP-ribosylation factor-like protein 6-interacting protein 1(Arl6ip1)

Recombinant Mouse ADP-ribosylation factor-like protein 6-interacting protein 1(Arl6ip1)

SKU:CSB-CF862402MO

Regular price £1,270.00 GBP
Regular price Sale price £1,270.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9JKW0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFSLKEEKPKMYFMTMIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGII LKYIGMAKREINKLLKQKEKKNE

Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 1 Short name= ARL-6-interacting protein 1 Short name= Aip-1 Alternative name(s): Protein TBX2

Gene Names:Name:Arl6ip1 Synonyms:Arl6ip

Expression Region:1-203

Sequence Info:full length protein

View full details