Recombinant Mouse Acid ceramidase(Asah1),partial

SKU: CSB-EP895296MO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9WV54

Gene Names: Asah1

Organism: Mus musculus (Mouse)

AA Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM

Expression Region: 19-141aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10XHis-GST-tagged and C-terminal Myc-tagged

MW: 43.8 kDa

Alternative Name(s): Acylsphingosine deacylase N-acylsphingosine amidohydrolase

Relevance: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Reference: "Cloning and characterization of the full-length cDNA and genomic sequences encoding murine acid ceramidase."Li C.-M., Hong S.-B., Kopal G., He X., Linke T., Hou W.-S., Koch J., Gatt S., Sandhoff K., Schuchman E.H.Genomics 50:267-274(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.