Skip to product information
1 of 1

Gene Bio Systems

Recombinant Moorella thermoacetica Glycerol-3-phosphate acyltransferase 2(plsY2)

Recombinant Moorella thermoacetica Glycerol-3-phosphate acyltransferase 2(plsY2)

SKU:CSB-CF649330MUG

Regular price £1,264.00 GBP
Regular price Sale price £1,264.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Moorella thermoacetica (strain ATCC 39073)

Uniprot NO.:Q2RIV5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWLLALVVAYLIGSIPTAYVVGRYLYGFDIRRRGSGNVGATNTLRTMGTIPGLVVLGVDA LKGVLAVLLGQALGGPVLVILAALMAIVGHNWSIFLEFQGGRGVATTAGALLAMAPLALF WAFLIWLAVVIFSRYISLGSIVAAAVAPFLVIYFHRPWPYVLFTFVAAALVIYRHRPNIK RLLAGTEHKLGERS

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 2 Alternative name(s): Acyl-PO4 G3P acyltransferase 2 Acyl-phosphate--glycerol-3-phosphate acyltransferase 2 G3P acyltransferase 2 Short name= GPAT 2 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY2 Ordered Locus Names:Moth_1321

Expression Region:1-194

Sequence Info:full length protein

View full details