Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mitochondrial import inner membrane translocase subunit tim-22(tim-22)

Recombinant Mitochondrial import inner membrane translocase subunit tim-22(tim-22)

SKU:CSB-CF873581CXY

Regular price £1,277.00 GBP
Regular price Sale price £1,277.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q9NAQ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALASSNATSMEELFGNPFRPKKERVVVEEKPFEYTPSAYVQMIDQMIGIKTRPWNPERT PIKPIQMLTLPEMSREERWIQWGMENCTVKASISGVLGVGVGFAFGLFTASVDPQLSMVG GDPTKQLTLKQTWKEMSSRMKSYGKNFGSIGLMFSGTECALETIRAKSDWRNGTYSGGIV GGLLGLRAGIMPAVWGAAGFAVFSTIIDHYMRG

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim-22

Gene Names:Name:tim-22 ORF Names:C47G2.3

Expression Region:1-213

Sequence Info:full length protein

View full details