Gene Bio Systems
Recombinant Mitochondrial fission process protein 1(mtp-18)
Recombinant Mitochondrial fission process protein 1(mtp-18)
SKU:CSB-CF840540CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q8T3C8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSIDKGL QEYIKTHSTSTEKTKKVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNEPTISNKE
Protein Names:Recommended name: Mitochondrial fission process protein 1 Alternative name(s): Mitochondrial 18 kDa protein Short name= MTP18
Gene Names:Name:mtp-18 ORF Names:T13C5.8
Expression Region:1-166
Sequence Info:full length protein
