Gene Bio Systems
Recombinant Microcystis aeruginosa NAD(P)H-quinone oxidoreductase subunit 3
Recombinant Microcystis aeruginosa NAD(P)H-quinone oxidoreductase subunit 3
SKU:CSB-CF534613MTQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Microcystis aeruginosa (strain NIES-843)
Uniprot NO.:B0JSV4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFVLKGYEYFLGFLLACSLVPILSLTASKVLRPSGGGPERRTTYESGMEPIGGAWIQFNI RYYMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVVALVYAWRKGALEWS
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 Short name= NDH-C
Gene Names:Name:ndhC Ordered Locus Names:MAE_11760
Expression Region:1-120
Sequence Info:full length protein
