Skip to product information
1 of 1

Gene Bio Systems

Recombinant Metridium senile ATP synthase protein 8(MTATP8)

Recombinant Metridium senile ATP synthase protein 8(MTATP8)

SKU:CSB-CF015071MTL

Regular price £1,156.00 GBP
Regular price Sale price £1,156.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Metridium senile (Brown sea anemone) (Frilled sea anemone)

Uniprot NO.:O47493

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMPQLETATYLTQYRWTLIALFLLFSFLVVSVLPAVKTNFLIRRSIGAGWTGAPKTSDLN KGPASLWSWDKI

Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8

Gene Names:Name:MTATP8 Synonyms:ATP8, ATPASE8

Expression Region:1-72

Sequence Info:full length protein

View full details