Gene Bio Systems
Recombinant Methylobacterium sp. UPF0060 membrane protein M446_5886 (M446_5886)
Recombinant Methylobacterium sp. UPF0060 membrane protein M446_5886 (M446_5886)
SKU:CSB-CF537585MTE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methylobacterium sp. (strain 4-46)
Uniprot NO.:B0UHJ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTLLAYALAALAEIAGCFAIWAWLRLGRSPLWLGPGLASLILFAVLLTRVESAAAGRAY AAYGGVYVAASLLWLWAAEGQRPDRWDLGGAALCLAGSAVVLLGPRG
Protein Names:Recommended name: UPF0060 membrane protein M446_5886
Gene Names:Ordered Locus Names:M446_5886
Expression Region:1-107
Sequence Info:full length protein
