Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methylobacillus flagellatus UPF0059 membrane protein Mfla_1363(Mfla_1363)

Recombinant Methylobacillus flagellatus UPF0059 membrane protein Mfla_1363(Mfla_1363)

SKU:CSB-CF626608MAAN

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

Uniprot NO.:Q1H1K6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIVSTLLLALAMSADAFAAAVSKGAMLHRPRIIEALRTGMIFGVIEATTPLVGWSLGRV AADYVTAWDHWIAFSILAFLGIRMTWSGLKHDGKVVEKSRSHSFILLAMTALGTSIDAMS VGVSLAFLDIDIVPVAFAIGIVTCIMVSAGVMLGRVLGSASKHTVEIIGGLILIGIGSLI LYKHLYGAA

Protein Names:Recommended name: UPF0059 membrane protein Mfla_1363

Gene Names:Ordered Locus Names:Mfla_1363

Expression Region:1-189

Sequence Info:full length protein

View full details