Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_215 (MTH_215)

Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_215 (MTH_215)

SKU:CSB-CF519652MSR

Regular price £1,292.00 GBP
Regular price Sale price £1,292.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Uniprot NO.:O26317

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMYKVRNMRETEVVISDKTANPAPLGLLGFGITTILLNLHNAGLFPINSMILAMGFAYGG IAQILASVMEYRKGNTFGTVAFGSYGLFWWSLVLLLVIPNLKFLETSGTAAASADPVAMA SYLFMWGLFTLLMFIATLKLKRGIQVIFISLAVLFFLLTAGEITGSALITAVAGYEGIFT GAAAMYVGLAEVINETHGRDILPT

Protein Names:Recommended name: Uncharacterized protein MTH_215

Gene Names:Ordered Locus Names:MTH_215

Expression Region:1-204

Sequence Info:full length protein

View full details