Gene Bio Systems
Recombinant Methanosphaera stadtmanae UPF0059 membrane protein Msp_0741(Msp_0741)
Recombinant Methanosphaera stadtmanae UPF0059 membrane protein Msp_0741(Msp_0741)
SKU:CSB-CF649105MAAR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Methanosphaera stadtmanae (strain DSM 3091)
Uniprot NO.:Q2NGB4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSVILLAIALAMDAFSISITKGFTQKKIQKQEILWYGIFFGGFQCFMPIIGYVCGTTIR SFISTYAPWIAFILLLCIGLNMIRESITSSDEKVADIFSFKEVTLLAIATSIDAFAVGVT FAILNISLVIPCAIIGIITFLFSIVGIFIGKKLGDYFGDKFQILGGVILILLGFKILLGF
Protein Names:Recommended name: UPF0059 membrane protein Msp_0741
Gene Names:Ordered Locus Names:Msp_0741
Expression Region:1-180
Sequence Info:full length protein
