Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosarcina mazei UPF0059 membrane protein MM_0643(MM_0643)

Recombinant Methanosarcina mazei UPF0059 membrane protein MM_0643(MM_0643)

SKU:CSB-CF844394MSN

Regular price £1,273.00 GBP
Regular price Sale price £1,273.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)

Uniprot NO.:Q8PZ51

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFLTNFLLGLGLAMDAFAVSMSSGTTVRPFKVSDALKLAVFFGGFQALMPVLGWVGGSA VSGFVSDYAPWIAFGLLAFIGGKMIYEALYGDPDGKVNSLNYSMLFLLAVATSIDALAVG ISFAFLGTPILEPVIIIGCVTFVMSFCGAVLGYRIGHFFENEVEILGGLILIGLGVKILA EHMDWI

Protein Names:Recommended name: UPF0059 membrane protein MM_0643

Gene Names:Ordered Locus Names:MM_0643

Expression Region:1-186

Sequence Info:full length protein

View full details