Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

SKU:CSB-CF301375MSN

Regular price £1,191.00 GBP
Regular price Sale price £1,191.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)

Uniprot NO.:P80655

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SIVRIAPEINLVMDTESGTVTQERKDSIQYSMEPVFERVDKLDAIADDLVNSLSPSKPLL NTWPGRENTSYIAGIYSNSFYGIIVGLAFSGLLALIIYITRLMGGVV

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit B EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

Gene Names:Name:mtrB Ordered Locus Names:MM_1544

Expression Region:2-108

Sequence Info:full length protein

View full details