Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosarcina barkeri UPF0059 membrane protein Mbar_A0247(Mbar_A0247)

Recombinant Methanosarcina barkeri UPF0059 membrane protein Mbar_A0247(Mbar_A0247)

SKU:CSB-CF676130MSM

Regular price £1,273.00 GBP
Regular price Sale price £1,273.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanosarcina barkeri (strain Fusaro / DSM 804)

Uniprot NO.:Q46FW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFLTNFLLGLGLSMDAFAVSMSSSTTIRPFHQKDALKLAVFFGGFQAFMPVLGWLGGSA VSGFVSNYASWIAFGLLTFIGGKMIYEALYGDPDGKINSLNYSVLLMLAIATSIDALAVG ISFAFLNTPILEPVIIIGCVTFVMSFCGAVLGHRIGHFFEHEVEIIGGLILIGIGGKILA EHLLWI

Protein Names:Recommended name: UPF0059 membrane protein Mbar_A0247

Gene Names:Ordered Locus Names:Mbar_A0247

Expression Region:1-186

Sequence Info:full length protein

View full details