Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosaeta thermophila UPF0290 protein Mthe_1386 (Mthe_1386)

Recombinant Methanosaeta thermophila UPF0290 protein Mthe_1386 (Mthe_1386)

SKU:CSB-CF366941MNW

Regular price £1,253.00 GBP
Regular price Sale price £1,253.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanosaeta thermophila (strain DSM 6194 / PT) (Methanothrix thermophila (strain DSM 6194 / PT))

Uniprot NO.:A0B8Y7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIIVHSIWLMLPAYVPNNFAALFGGGTPLDMGMSLPDGHRVFGNGKTIRGTIAGVAGGI IVGLLQNSIAGVFGLPSFGDGMELFLVLFGLSAGSMLGDLTASFIKRRLGMKRGASFFLV DQLDFVMGAWALTFLLAPEWFNAQFTSPVIILVLLITPVLHRFANVIGYMIGAKKEPW

Protein Names:Recommended name: UPF0290 protein Mthe_1386

Gene Names:Ordered Locus Names:Mthe_1386

Expression Region:1-178

Sequence Info:full length protein

View full details