Gene Bio Systems
Recombinant Methanoregula boonei UPF0290 protein Mboo_0842 (Mboo_0842)
Recombinant Methanoregula boonei UPF0290 protein Mboo_0842 (Mboo_0842)
SKU:CSB-CF417026MNV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanoregula boonei (strain 6A8)
Uniprot NO.:A7I6J9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVPAYIPNPVAALCGGGTPIDFCRNYTDGRRILGNGKTYRGLICGVLAGVLIGLVQIWLV GTYHWDLPRQTILSVTLLALGALLGDMGKSFIKRRLGKERGEAWPVADQYDLVVGAFLLT IIFDPAWFFAVVTLPVLIAILVITPVLHRSVNILGYWIKVKKEPW
Protein Names:Recommended name: UPF0290 protein Mboo_0842
Gene Names:Ordered Locus Names:Mboo_0842
Expression Region:1-165
Sequence Info:full length protein
