Gene Bio Systems
Recombinant Methanoculleus marisnigri UPF0290 protein Memar_1002 (Memar_1002)
Recombinant Methanoculleus marisnigri UPF0290 protein Memar_1002 (Memar_1002)
SKU:CSB-CF387399MNU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Uniprot NO.:A3CU85
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIPAYVPNSAAALFGGGTPIDLGRTFSDGRRVFGDGKTYRGFFGGVVSGVLVGLIEIWAA TAFSLSALPQQTFLSVTLLATGALLGDLAKSFLKRRLGKDRGESWFLADQYDLVVGSFLL ILIFDPQWLFGTITLPIAVWIVVMTPLLHRVVNIIGYYIGVKEVPW
Protein Names:Recommended name: UPF0290 protein Memar_1002
Gene Names:Ordered Locus Names:Memar_1002
Expression Region:1-166
Sequence Info:full length protein
