Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanoculleus marisnigri UPF0059 membrane protein Memar_2039 (Memar_2039)

Recombinant Methanoculleus marisnigri UPF0059 membrane protein Memar_2039 (Memar_2039)

SKU:CSB-CF383886MNU

Regular price £1,272.00 GBP
Regular price Sale price £1,272.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)

Uniprot NO.:A3CX65

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLVTTLLIAVGLAMDAFAVSISGGATLREERLRWAVIAGALFGGFQAGMPVLGWLGGMG LASFVGTYGPWIAFLLLALIGGKMIAEAVRGDGESVRFENGATVLLLLAVATSIDALAVG VSFAVLDTAIALPAITIGVVTFAFSAAGVLLGSAFGHIMGRKACIVGGIILVGIGLRILL EHLFF

Protein Names:Recommended name: UPF0059 membrane protein Memar_2039

Gene Names:Ordered Locus Names:Memar_2039

Expression Region:1-185

Sequence Info:full length protein

View full details