Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanobrevibacter smithii UPF0059 membrane protein Msm_0030 (Msm_0030)

Recombinant Methanobrevibacter smithii UPF0059 membrane protein Msm_0030 (Msm_0030)

SKU:CSB-CF404105MNN

Regular price £1,271.00 GBP
Regular price Sale price £1,271.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861)

Uniprot NO.:A5UJ57

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTSLISIIIIAIALAMDAFSVSLTKGFTQKNLTKSQILYYGLFFGFFQFIMPVIGYICG TTISSFVSTVAPWIAFFLLLAIGLNMIRESLDSDDEYIMDTFSFKELTLLAVATSIDAFA VGITFALLNMSLLLPCTIIGIVAFIFSISGIFIGKKLGNYFGDKFEILGGAVLILIGIKI LLGY

Protein Names:Recommended name: UPF0059 membrane protein Msm_0030

Gene Names:Ordered Locus Names:Msm_0030

Expression Region:1-184

Sequence Info:full length protein

View full details