Skip to product information
1 of 1

Gene Bio Systems

Recombinant Marchantia polymorpha Succinate dehydrogenase cytochrome b560 subunit(SDH3)

Recombinant Marchantia polymorpha Succinate dehydrogenase cytochrome b560 subunit(SDH3)

SKU:CSB-CF020908MCB

Regular price £1,212.00 GBP
Regular price Sale price £1,212.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Uniprot NO.:P35721

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKINRPLSPHLTIYKPQLTSTFSIFHRISGAFLATMVLFSILFFKIGDLSLTFYHFYQYF FFLTFYLNWFIISLVNFTLLALCYHMSNGVRHLLWDLGFFLELSKVYTSGIIMLFCAAFL ALLNIIRQHWSNGQIPY

Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit Alternative name(s): Succinate dehydrogenase, subunit III

Gene Names:Name:SDH3 Synonyms:SDHC, YMF24

Expression Region:1-137

Sequence Info:full length protein

View full details