Gene Bio Systems
Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein(YMF18)
Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein(YMF18)
SKU:CSB-CF327838MCB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Uniprot NO.:P38461
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLCRTNVLHLRPQLNKFTYLTQFLWLCLFYITFYFVLYSVLVFTNTEWPFILLKKRLVSQ EKIRAYQSNDCVGQTRGLTSEPSWRDACWRALILAYLTSIYFFPILGSFPRVLKDQVDFG YIPTVCILLYVIFLFFFDSYRKSLFTTALTHSFWL
Protein Names:Recommended name: Putative ATP synthase protein YMF19-like protein Alternative name(s): ORF 155
Gene Names:Name:YMF18
Expression Region:1-155
Sequence Info:full length protein
