Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mannheimia succiniciproducens UPF0059 membrane protein MS0192(MS0192)

Recombinant Mannheimia succiniciproducens UPF0059 membrane protein MS0192(MS0192)

SKU:CSB-CF737598MAAB

Regular price £1,275.00 GBP
Regular price Sale price £1,275.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mannheimia succiniciproducens (strain MBEL55E)

Uniprot NO.:Q65W61

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLFSLWVMAFGLSMDAFAVSICKGLAMEKFQWCGALKAGLYFGLFQAVMPLIGFLLGVQ FSEYITDYDHWVAFFLLALIGVNMLRESLSDEDDEDSCSNDFNFKTMMTLGFATSIDALA VGVTFAFLSVDIYSSVVTIGLITAALSIIGVKSGHFLGKKIKTKAEILGGLILIGLGVKI LMEHTLFG

Protein Names:Recommended name: UPF0059 membrane protein MS0192

Gene Names:Ordered Locus Names:MS0192

Expression Region:1-188

Sequence Info:full length protein

View full details