Skip to product information
1 of 1

Gene Bio Systems

Recombinant Malassezia globosa Protein GET1(GET1)

Recombinant Malassezia globosa Protein GET1(GET1)

SKU:CSB-CF428514MNH

Regular price £1,285.00 GBP
Regular price Sale price £1,285.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)

Uniprot NO.:A8PTK5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYITNDEFRVFYVRIVRFSASSKLSSMKKELFETRQLMNMTSAQDEFSKWAKLRRRVDKL SSQVDEQNKSLASSQFVYSIMFKSFMFVLNSAIPFVLNWYYKRVPMFYLPPGDWFGPMGY LFSFPNAPAGAVSSTVWTTVCGRVLALVGEYARELFVKDAYLVAEPPMTTEKSSGDKETT SKLSTNKPAAMTGEKFDFGKEVKEADQPQGILKQRRANKSSD

Protein Names:Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:GET1 ORF Names:MGL_0439

Expression Region:1-222

Sequence Info:full length protein

View full details