Skip to product information
1 of 1

Gene Bio Systems

Recombinant Maize streak virus genotype C Movement protein (V2)

Recombinant Maize streak virus genotype C Movement protein (V2)

SKU:CSB-CF522084MPQ

Regular price £1,181.00 GBP
Regular price Sale price £1,181.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Maize streak virus genotype C (isolate Set) (MSV)

Uniprot NO.:O40984

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLEPTAPVHPGPFVPGQG

Protein Names:Recommended name: Movement protein Short name= MP

Gene Names:ORF Names:V2

Expression Region:1-101

Sequence Info:full length protein

View full details