Skip to product information
1 of 1

Gene Bio Systems

Recombinant Magnaporthe oryzae Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Magnaporthe oryzae Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF390709MPM

Regular price £1,283.00 GBP
Regular price Sale price £1,283.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)

Uniprot NO.:A4RI25

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPTTGPPPPLPGDRPLPSSFDNDEDFYNENGFQKIARKLKQEPLVPLGCVLTVAAFTGAY RAMRAGDHGRVNRMFRYRIAAQGFTILAMVAGGIYYSDDRHKEREMWKAKRDADEEEKRL KWIKELEARDEEDKLAKEIMDKRRQRAAAAAAKREGRAVEDKAAEGGAAAAQDAKSSSGL SWASAPGWFGGNKNEPDANAQTNTGDAEKPSEK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:MGG_07223

Expression Region:1-213

Sequence Info:full length protein

View full details