Gene Bio Systems
Recombinant Macrococcus caseolyticus Large-conductance mechanosensitive channel(mscL)
Recombinant Macrococcus caseolyticus Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF498346MPA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Macrococcus caseolyticus (strain JCSC5402)
Uniprot NO.:B9EBV2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLLKEFKEFAVKGNVLDLAVAVVIGAAFGKIVSSLVADVIMPIIGLIFGNTDFASSWAY KGIKYGVFIQSIVDFLIVAGAIFLFIKLINKITRKSEVEEVEEAVEENTVLLTEIRDLLR SK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:MCCL_1006
Expression Region:1-122
Sequence Info:full length protein
