Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)

SKU: F6S8F9

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: F6S8F9

Gene Names: TNFSF15

Alternative Name(s): TNF superfamily member 15; Tumor necrosis factor ligand 1B

Abbreviation: Recombinant Rhesus macaque TNFSF15 protein, partial, Biotinylated (Active)

Organism: Macaca mulatta (Rhesus macaque)

Source: Mammalian cell

Expression Region: 72-251aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-Avi-tagged

Target Protein Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

MW: 25.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) at 2 μg/mL can bind Biotinylated Macaca mulatta TNFSF15. The EC50 is 0.2589-0.3025 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: Evolutionary and biomedical insights from the rhesus macaque genome. Gibbs R.A., Rogers J., Katze M.G., Bumgarner R., Weinstock G.M., Mardis E.R., Remington K.A., Strausberg R.L., Venter J.C., Zwieg A.S Science 316: 222-234 (2007)

Function: