Gene Bio Systems
Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor(TNF)
Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor(TNF)
SKU:CSB-CF023955MOW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Macaca mulatta (Rhesus macaque)
Uniprot NO.:P48094
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTESMIRDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGATTLFCLLHFGVIGPQREEFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
Protein Names:Recommended name: Tumor necrosis factor Alternative name(s): Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 Short name= TNF-a Cleaved into the following 6 chains: 1. Tumor necrosis factor, membrane form Alternative name(s): N-terminal fragment Short name= NTF Intracellular domain 1 Short name= ICD1 Intracellular domain 2 Short name= ICD2 C-domain 1 C-domain 2 Tumor necrosis factor, soluble form
Gene Names:Name:TNF Synonyms:TNFA, TNFSF2
Expression Region:1-233
Sequence Info:full length protein
