Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha(TGFA)

SKU: CSB-CF023445MOW

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca mulatta (Rhesus macaque)

Uniprot NO.:P55244

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDRPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPS

Protein Names:Recommended name: Protransforming growth factor alpha Cleaved into the following chain: 1. Transforming growth factor alpha Short name= 2. TGF-alpha Alternative name(s): EGF-like TGF Short name= ETGF TGF type 1

Gene Names:Name:TGFA

Expression Region:2-121

Sequence Info:full length protein