Gene Bio Systems
Recombinant Macaca fascicularis Transthyretin(TTR)
Recombinant Macaca fascicularis Transthyretin(TTR)
SKU:CSB-MP025270MOV
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20170725
Research areas: Cardiovascular
Target / Protein: TTR
Biologically active: Not Tested
Expression system: Mammalian cell
Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Delivery time: 3-7 business days
Uniprot ID: Q8HXW1
AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
Tag info: N-terminal 6xHis-tagged
Expression Region: 21-147aa
Protein length: Full Length of Mature Protein
MW: 17.7 kDa
Alternative Name(s): Prealbumin
Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Reference: "Isolation and characterization of cDNA for macaque neurological disease genes."Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
