Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Transmembrane protein 35(TMEM35)

Recombinant Macaca fascicularis Transmembrane protein 35(TMEM35)

SKU:CSB-CF023830MOV

Regular price £1,238.00 GBP
Regular price Sale price £1,238.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q4R5F4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Protein Names:Recommended name: Transmembrane protein 35

Gene Names:Name:TMEM35 ORF Names:QnpA-14372

Expression Region:1-167

Sequence Info:full length protein

View full details