Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain(CD3G),partial

Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain(CD3G),partial

SKU:CSB-YP850179MOV

Regular price £959.00 GBP
Regular price Sale price £959.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Immunology

Uniprot ID: Q95LI7

Gene Names: CD3G

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Expression Region: 23-113aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 12.5 kDa

Alternative Name(s): T-cell receptor T3 gamma chain CD_antigen: CD3g

Relevance: The CD3 complex mediates signal transduction.

Reference: "CD3 polymorphism in cynomolgus monkeys (Macaca fascicularis)."Uda A., Tanabayashi K., Mukai R., Yachi M., Nam K., Yamada A.J. Med. Primatol. 30:141-147(2001) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details