Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Elongation of very long chain fatty acids protein 4(ELOVL4)

Recombinant Macaca fascicularis Elongation of very long chain fatty acids protein 4(ELOVL4)

SKU:CSB-CF856808MOV

Regular price £1,371.00 GBP
Regular price Sale price £1,371.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q95K73

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNFFIFRELFMGSYNAGYSYICQSVDYSNNVN EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQMNSFIHVIMYSYYGLAAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKTGKTAMNGISANGVSKSEKQLVI ENGKKQKNGKAKGD

Protein Names:Recommended name: Elongation of very long chain fatty acids protein 4 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase Elovl4 ELOVL fatty acid elongase 4 Short name= ELOVL FA elongase 4

Gene Names:Name:ELOVL4 ORF Names:QtrA-14469

Expression Region:1-314

Sequence Info:full length protein

View full details