Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lodderomyces elongisporus Probable endonuclease LCL3(LCL3)

Recombinant Lodderomyces elongisporus Probable endonuclease LCL3(LCL3)

SKU:CSB-CF398548LLV

Regular price £1,329.00 GBP
Regular price Sale price £1,329.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)

Uniprot NO.:A5E1Q5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPVPVNSTSQDYYGVLEPRVWLLSAGLAASAIFSYKIYRRYFRRIRSILDFTPEALEKN HKLYGYVTRVGDGDNFRFYHTPGGWLLGWGWLRKVPLDNRRIMKDETLMIRLCGVDAPER AHFGKPAQPFSEDALLWLKNYLLGRYVTVTPYSIDQYKRIVGRCQVWKWNGKKDVSAEML KNGVAIVYEGKVGAEFGDNEDRYRSLEKRAKWLKRGVWSIGKKMMTPGEYKKVYYRGE

Protein Names:Recommended name: Probable endonuclease LCL3 EC= 3.1.-.-

Gene Names:Name:LCL3 ORF Names:LELG_03542

Expression Region:1-238

Sequence Info:full length protein

View full details