Gene Bio Systems
Recombinant Lodderomyces elongisporus Golgi apparatus membrane protein TVP18(TVP18)
Recombinant Lodderomyces elongisporus Golgi apparatus membrane protein TVP18(TVP18)
SKU:CSB-CF398936LLV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Uniprot NO.:A5DSM9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALGETITQNVFGGLSNDFKKKNFSLYGQWISIFTIFLCIALGIANIFHFNLVIIFSVIC IVQGLIVIFVEVPFLLRICPLTDTFTNFIRKFDGNLPRCGFYLLNAVIQWLSCTLQATSL IVVAIFFTLASACYALAYAKNQEYLKSSIDVTGTGQGGALEAQVGEHVVRNVL
Protein Names:Recommended name: Golgi apparatus membrane protein TVP18
Gene Names:Name:TVP18 ORF Names:LELG_00365
Expression Region:1-173
Sequence Info:full length protein
