Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lithobates catesbeiana Saxiphilin ,partial

Recombinant Lithobates catesbeiana Saxiphilin ,partial

SKU:CSB-BP339158LQA(A5)

Regular price £490.00 GBP
Regular price Sale price £490.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Others

Uniprot ID: P31226

Gene Names: N/A

Organism: Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

AA Sequence: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC

Expression Region: 484-844aa

Sequence Info: Partial

Source: Baculovirus

Tag Info: N-terminal 6xHis-tagged

MW: 41.7 kDa

Alternative Name(s): Short name: SAX

Relevance: Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Reference: "Molecular cloning of bullfrog saxiphilin: a unique relative of the transferrin family that binds saxitoxin."Morabito M.A., Moczydlowski E.Proc. Natl. Acad. Sci. U.S.A. 91:2478-2482(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details