Gene Bio Systems
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Glycerol-3-phosphate acyltransferase(plsY)
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Glycerol-3-phosphate acyltransferase(plsY)
SKU:CSB-CF348538LOS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Uniprot NO.:P59247
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFPIFALFSFVSGSIPFGYWIALRFAGVDIRKLGSKNIGATNVGRLIGWKFGFIVLALD ITKGMLPVYLSSVYVPEGGIPFQLLCGVCAVLGHMFSPFLGFRGGKGVATTFGVFLVLTP IACLGAVLVFWVVYKFFKFVSLGSIFASITLPLVYAFSTILLLHEEVSYWVLGTMVFISF GIILTHRENIIRILNRSELFAVKGEEQDGDSERNRR
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Ordered Locus Names:LA_1304
Expression Region:1-216
Sequence Info:full length protein
