Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lemur catta ATP synthase subunit a(MT-ATP6)

Recombinant Lemur catta ATP synthase subunit a(MT-ATP6)

SKU:CSB-CF843076LOK

Regular price £1,312.00 GBP
Regular price Sale price £1,312.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lemur catta (Ring-tailed lemur)

Uniprot NO.:Q8LX27

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNENLFASFITPTIVGIPIVILIIMTPYIIFPSPTRLINNRLTSLQQWLVQLILKQLMSI HNTKGRTWSLMLISLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAATVIKGFRHK TKASLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV LTSISPATASITFIILTLLTILEFAVALIQAYVFTLLVSLYLHDNT

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:MT-ATP6 Synonyms:ATP6, ATPASE6, MTATP6

Expression Region:1-226

Sequence Info:full length protein

View full details