Gene Bio Systems
Recombinant Lactococcus lactis subsp. lactis Prolipoprotein diacylglyceryl transferase(lgt),Nanodisc
Recombinant Lactococcus lactis subsp. lactis Prolipoprotein diacylglyceryl transferase(lgt),Nanodisc
SKU:CSB-CF875009LNG-N
Couldn't load pickup availability
Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:Q9CHU9
Gene Names:lgt
Organism:Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
AA Sequence:MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN
Expression Region:1-261aa
Sequence Info:Full Length
Source:in vitro E.coli expression system
Tag Info:C-terminal 6xHis-tagged
MW:32.6 kDa
Alternative Name(s):/
Relevance:Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.
Reference:"The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403." Bolotin A., Wincker P., Mauger S., Jaillon O., Malarme K., Weissenbach J., Ehrlich S.D., Sorokin A. Genome Res. 11:731-753(2001)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:18-23 business days
