Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. lactis Membrane protein insertase YidC 2(yidC2)

Recombinant Lactococcus lactis subsp. lactis Membrane protein insertase YidC 2(yidC2)

SKU:CSB-CF887329LNG

Regular price £1,348.00 GBP
Regular price Sale price £1,348.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Uniprot NO.:Q9CHZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CVQTHVVDGVRVPTEAATHGITYNFLVRPMSAFVDLFANNLHMGYGWGIIFVTLIIRFLI LPLGLNQAYKSTYMQEKMAYLAPVFAPLQERLKKAQTPEEKMAAQQALMAAQKDNGINML SSIGCLPMLIQWPFFIALYNAAAYTTGISSSTFYGIPLGHPSVVLVIISGVLYFIQTWIS TLSMTPEQKKSGMAMLIMSPAMIVVFSFMSPAGVALYWAVGGFVIVIQQIIITFIMKPRM RRRIDEEFTKNPPKINNEGLKDVTPTSVQENFKEITSERNEKERKSGGRNAGKQNRK

Protein Names:Recommended name: Membrane protein insertase YidC 2 Alternative name(s): Foldase YidC 2 Membrane integrase YidC 2 Membrane protein YidC 2

Gene Names:Name:yidC2 Ordered Locus Names:LL0569 ORF Names:L164312

Expression Region:24-320

Sequence Info:full length protein

View full details