Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris Pantothenic acid transporter PanT(panT)

Recombinant Lactococcus lactis subsp. cremoris Pantothenic acid transporter PanT(panT)

SKU:CSB-CF382294LND

Regular price £1,286.00 GBP
Regular price Sale price £1,286.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (strain MG1363)

Uniprot NO.:A2RIQ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKSKASDVAILAIFIAIMVVVQLFTQFVINVWPFPVKPTLLHLPVIIGSIILGWRKGAF LGLVWGLISFVTATIVTTPTSFLFSPFQPVIGTHHGSPWGLFIAFIPRILVGILPYFVYK IANNRLGAGLAAFAGTATNTVLVLTSIFLFFGSTLKWSLSYLLGAIVATNSLTEVIIAVI LTTAIVPALTKARNNS

Protein Names:Recommended name: Pantothenic acid transporter PanT Alternative name(s): Pantothenic acid ECF transporter S component PanT

Gene Names:Name:panT Ordered Locus Names:llmg_0542

Expression Region:1-196

Sequence Info:full length protein

View full details