Gene Bio Systems
Recombinant Lactobacillus salivarius UPF0756 membrane protein LSL_0936(LSL_0936)
Recombinant Lactobacillus salivarius UPF0756 membrane protein LSL_0936(LSL_0936)
SKU:CSB-CF631257LAAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus salivarius (strain UCC118)
Uniprot NO.:Q1WTL2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESWIFLGLILLIAYLGKNSSLLIAGAVVIVIKLFPFLSQKLYPVIQAKGINWGVTIISV AILIPIATGQIQFKDLINAMKTPAGWIAVVCGILVAILSKHGVNLLSSTPQVTVALVIGT IIGVVFLKGVAAGPVIAAGITYYLVTLLNLSFS
Protein Names:Recommended name: UPF0756 membrane protein LSL_0936
Gene Names:Ordered Locus Names:LSL_0936
Expression Region:1-153
Sequence Info:full length protein
