Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus plantarum Membrane protein insertase YidC 2(yidC2)

Recombinant Lactobacillus plantarum Membrane protein insertase YidC 2(yidC2)

SKU:CSB-CF801645LMS

Regular price £1,341.00 GBP
Regular price Sale price £1,341.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Uniprot NO.:Q88RX1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CSNTPITDKSTGFWDGLIILNFSRAIIWLSNLFGHSYGLGIIVFTLIIRIIILPLMIFQT RNMVAMQEVQPQMKALQKKYSSRDMETQQKLQAEMKKLYAKHGVHPMASMLPLLVQLPIL IALYQAIWRTQALKTGSFLWLQLGSKDPYYVLPILAAIFTFASSWLAMKSQPEQNGMTTS MTYLMPVIILITAINVPSALSLYWVISNAFQVGQTLLLQNPFKINREREAKKQAERDRKR TLEKARKRAIRNHKR

Protein Names:Recommended name: Membrane protein insertase YidC 2 Alternative name(s): Foldase YidC 2 Membrane integrase YidC 2 Membrane protein YidC 2

Gene Names:Name:yidC2 Ordered Locus Names:lp_3687

Expression Region:23-277

Sequence Info:full length protein

View full details