Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lachancea thermotolerans Autophagy-related protein 33(ATG33)

Recombinant Lachancea thermotolerans Autophagy-related protein 33(ATG33)

SKU:CSB-CF512869LMB

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)

Uniprot NO.:C5DNL7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVCLAVTKTVAVSSLGIYCGMLTSACVASYAAPVDVLTQLAKPARVIARVGGALAAVSS AFFALSYFGAPAHWRHPYLLYGMLVAPVSAAYVAVVARVRGAHCRRACEKRRAQSASVHA STPASAAPEPALDDSVVDLGAAAAAAESAPETHVTSAEHVPVSHHVTPASAACARAAARH AAVLLLPAAAGLLGSVLGLYGEGLFV

Protein Names:Recommended name: Autophagy-related protein 33

Gene Names:Name:ATG33 Ordered Locus Names:KLTH0G18172g

Expression Region:1-206

Sequence Info:full length protein

View full details