Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lachancea thermotolerans Altered inheritance of mitochondria protein 11(AIM11)

Recombinant Lachancea thermotolerans Altered inheritance of mitochondria protein 11(AIM11)

SKU:CSB-CF512493LMB

Regular price £1,228.00 GBP
Regular price Sale price £1,228.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)

Uniprot NO.:C5DE77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASVQLSSRDISVFSNEYKERRRLQMMRFFGATAFTLISARLAFRGVQSRKYVPNMFQLN HKPPTYSFQGEAVSALAFGTGLATGTFSMLVFGTCWVWDISSLAEFTLKMKKLMGEPVTD QALLENTPMDEDTRKVAEALEDMLKGSRKD

Protein Names:Recommended name: Altered inheritance of mitochondria protein 11

Gene Names:Name:AIM11 Ordered Locus Names:KLTH0C06930g

Expression Region:1-150

Sequence Info:full length protein

View full details