Skip to product information
1 of 1

GeneBio Systems

Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a

Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a

SKU:P60979

Regular price £728.00 GBP
Regular price Sale price £728.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P60979

Gene Names: N/A

Alternative Name(s): Omega-FLTX-Kh1a;Toxin DW13.3

Abbreviation: Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a protein

Organism: Kukulcania hibernalis (Southern house spider) (Filistata hibernalis)

Source: E.coli

Expression Region: 1-74aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: AECLMIGDTSCVPRLGRRCCYGAWCYCDQQLSCRRVGRKRECGWVEVNCKCGWSWSQRIDDWRADYSCKCPEDQ

MW: 15.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Potently blocks vertebrate calcium channels Cav1 and Cav2. Is the most active on Cav2.2/CACNA1B (from HEK) (IC(50)=2.3 nM), followed by Cav2.1/CACNA1A (IC(50)=4.3 nM), Cav2.2/CACNA1B (from oocyte) (IC(50)=14.4 nM), Cav1.2/CACNA1C (IC(50)=26.8 nM), and Cav2.3/CACNA1E (IC(50)=96.4 nM).

Reference:

Function:

View full details